PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g046737.1
Common NameMTR_4g046737
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 75aa    MW: 8495.25 Da    PI: 4.3473
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g046737.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.16.5e-112668246
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                       +++eE+ l+  + ++ G + W++Ia +++ gRt++++  +w++
  Medtr4g046737.1 26 VEFSEEEEMLITMVYNLVGER-WSLIAGRIP-GRTAEEIEKYWNS 68
                     578999999999999999999.*********.***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.54E-9969IPR009057Homeodomain-like
PROSITE profilePS512949.132074IPR017930Myb domain
SMARTSM007175.2E-92472IPR001005SANT/Myb domain
PfamPF002495.6E-102668IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-142768IPR009057Homeodomain-like
CDDcd001671.81E-73067No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MADTEHSSKN VTEVSTDQQS NQSSKVEFSE EEEMLITMVY NLVGERWSLI AGRIPGRTAE  60
EIEKYWNSRH STSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2086792e-41KF208679.1 Arachis hypogaea putative MYB-related protein 25 (MYB25) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013455622.14e-48myb transcription factor
SwissprotO220599e-18CPC_ARATH; Transcription factor CPC
TrEMBLA0A072UKM95e-48A0A072UKM9_MEDTR; Myb transcription factor
STRINGPOPTR_0004s02060.11e-31(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.15e-19MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]